Lineage for d1jqjd1 (1jqj D:213-333)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719131Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily)
    core: 5 helices: bundle
  4. 2719132Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families) (S)
    associated with N-terminal domain from the AAA+ family of P-loop hydrolases
  5. 2719133Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 proteins)
    contains an extra helix
  6. 2719142Protein delta subunit [63580] (1 species)
  7. 2719143Species Escherichia coli [TaxId:562] [63581] (4 PDB entries)
    Uniprot P28630
  8. 2719146Domain d1jqjd1: 1jqj D:213-333 [67099]
    Other proteins in same PDB: d1jqja1, d1jqja2, d1jqja3, d1jqjb1, d1jqjb2, d1jqjb3, d1jqjc2, d1jqjd2
    protein/DNA complex

Details for d1jqjd1

PDB Entry: 1jqj (more details), 2.9 Å

PDB Description: mechanism of processivity clamp opening by the delta subunit wrench of the clamp loader complex of e. coli dna polymerase iii: structure of the beta-delta complex
PDB Compounds: (D:) DNA Polymerase III, DELTA SUBUNIT

SCOPe Domain Sequences for d1jqjd1:

Sequence, based on SEQRES records: (download)

>d1jqjd1 a.80.1.1 (D:213-333) delta subunit {Escherichia coli [TaxId: 562]}
tpfhwvdallmgkskralhilqqlrlegsepvillrtlqrellllvnlkrqsahtplral
fdkhrvwqnrrgmmgealnrlsqtqlrqavqlltrteltlkqdygqsvwaeleglslllc
h

Sequence, based on observed residues (ATOM records): (download)

>d1jqjd1 a.80.1.1 (D:213-333) delta subunit {Escherichia coli [TaxId: 562]}
tpfhwvdallmgkskralhilqqlrlegsepvillrtlqrellllvnlkrqsahtplral
fdkhrvwrrgmmgealnrlsqtqlrqavqlltrteltlkqdygqaeleglslllch

SCOPe Domain Coordinates for d1jqjd1:

Click to download the PDB-style file with coordinates for d1jqjd1.
(The format of our PDB-style files is described here.)

Timeline for d1jqjd1: