![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.20: Extended AAA-ATPase domain [81269] (27 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
![]() | Protein delta subunit of DNA polymerase III, N-domain [64033] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [64034] (5 PDB entries) |
![]() | Domain d1jqjc2: 1jqj C:1-211 [67098] Other proteins in same PDB: d1jqja1, d1jqja2, d1jqja3, d1jqjb1, d1jqjb2, d1jqjb3, d1jqjc1, d1jqjd1 |
PDB Entry: 1jqj (more details), 2.9 Å
SCOP Domain Sequences for d1jqjc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jqjc2 c.37.1.20 (C:1-211) delta subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} mirlypeqlraqlneglraaylllgndplllqesqdavrqvaaaqgfeehhtfsidpntd wnaifslcqamslfasrqtlllllpengpnaaineqlltltgllhddlllivrgnklska qenaawftalanrsvqvtcqtpeqaqlprwvaarakqlnlelddaanqvlcycyegnlla laqalerlsllwpdgkltlprveqavndaah
Timeline for d1jqjc2: