Lineage for d1jqjc2 (1jqj C:1-211)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121667Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 121668Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) (S)
  5. 122576Family c.37.1.13: Extended AAA-ATPase domain [52700] (16 proteins)
  6. 122588Protein delta subunit of DNA polymerase III, N-domain [64033] (1 species)
  7. 122589Species Escherichia coli [TaxId:562] [64034] (3 PDB entries)
  8. 122592Domain d1jqjc2: 1jqj C:1-211 [67098]
    Other proteins in same PDB: d1jqja1, d1jqja2, d1jqja3, d1jqjb1, d1jqjb2, d1jqjb3, d1jqjc1, d1jqjd1

Details for d1jqjc2

PDB Entry: 1jqj (more details), 2.9 Å

PDB Description: mechanism of processivity clamp opening by the delta subunit wrench of the clamp loader complex of e. coli dna polymerase iii: structure of the beta-delta complex

SCOP Domain Sequences for d1jqjc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jqjc2 c.37.1.13 (C:1-211) delta subunit of DNA polymerase III, N-domain {Escherichia coli}
mirlypeqlraqlneglraaylllgndplllqesqdavrqvaaaqgfeehhtfsidpntd
wnaifslcqamslfasrqtlllllpengpnaaineqlltltgllhddlllivrgnklska
qenaawftalanrsvqvtcqtpeqaqlprwvaarakqlnlelddaanqvlcycyegnlla
laqalerlsllwpdgkltlprveqavndaah

SCOP Domain Coordinates for d1jqjc2:

Click to download the PDB-style file with coordinates for d1jqjc2.
(The format of our PDB-style files is described here.)

Timeline for d1jqjc2: