Lineage for d1jqjc1 (1jqj C:212-333)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 540726Fold a.80: DNA polymerase III clamp loader subunits, C-terminal domain [48018] (1 superfamily)
    core: 5 helices: bundle
  4. 540727Superfamily a.80.1: DNA polymerase III clamp loader subunits, C-terminal domain [48019] (1 family) (S)
    associated with N-terminal domain from the AAA+ family of P-loop hydrolases
  5. 540728Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 proteins)
    contains an extra helix
  6. 540737Protein delta subunit [63580] (1 species)
  7. 540738Species Escherichia coli [TaxId:562] [63581] (4 PDB entries)
  8. 540740Domain d1jqjc1: 1jqj C:212-333 [67097]
    Other proteins in same PDB: d1jqja1, d1jqja2, d1jqja3, d1jqjb1, d1jqjb2, d1jqjb3, d1jqjc2, d1jqjd2

Details for d1jqjc1

PDB Entry: 1jqj (more details), 2.9 Å

PDB Description: mechanism of processivity clamp opening by the delta subunit wrench of the clamp loader complex of e. coli dna polymerase iii: structure of the beta-delta complex

SCOP Domain Sequences for d1jqjc1:

Sequence, based on SEQRES records: (download)

>d1jqjc1 a.80.1.1 (C:212-333) delta subunit {Escherichia coli}
ftpfhwvdallmgkskralhilqqlrlegsepvillrtlqrellllvnlkrqsahtplra
lfdkhrvwqnrrgmmgealnrlsqtqlrqavqlltrteltlkqdygqsvwaeleglslll
ch

Sequence, based on observed residues (ATOM records): (download)

>d1jqjc1 a.80.1.1 (C:212-333) delta subunit {Escherichia coli}
ftpfhwvdallmgkskralhilqqlrlegsepvillrtlqrellllvnlkrqsahtplra
lfdkhrvwrrgmmgealnrlsqtqlrqavqlltrteltlkqdygqaeleglslllch

SCOP Domain Coordinates for d1jqjc1:

Click to download the PDB-style file with coordinates for d1jqjc1.
(The format of our PDB-style files is described here.)

Timeline for d1jqjc1: