Lineage for d1jqjb3 (1jqj B:245-366)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 334427Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 334428Superfamily d.131.1: DNA clamp [55979] (2 families) (S)
  5. 334429Family d.131.1.1: DNA polymerase III, beta subunit [55980] (1 protein)
    duplication: consists of three domains of this fold
  6. 334430Protein DNA polymerase III, beta subunit [55981] (1 species)
  7. 334431Species Escherichia coli [TaxId:562] [55982] (3 PDB entries)
  8. 334446Domain d1jqjb3: 1jqj B:245-366 [67096]
    Other proteins in same PDB: d1jqjc1, d1jqjc2, d1jqjd1, d1jqjd2
    mutant

Details for d1jqjb3

PDB Entry: 1jqj (more details), 2.9 Å

PDB Description: mechanism of processivity clamp opening by the delta subunit wrench of the clamp loader complex of e. coli dna polymerase iii: structure of the beta-delta complex

SCOP Domain Sequences for d1jqjb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jqjb3 d.131.1.1 (B:245-366) DNA polymerase III, beta subunit {Escherichia coli}
rrvlpknpdkhleagcdllkqafaraaaasnekfrgvrlyvsenqlkitannpeqeeaee
ildvtysgaemeigfnvsyvldvlnalkcenvrmmltdsvssvqiedaasqsaayvvmpm
rl

SCOP Domain Coordinates for d1jqjb3:

Click to download the PDB-style file with coordinates for d1jqjb3.
(The format of our PDB-style files is described here.)

Timeline for d1jqjb3: