SCOPe 2.08: Domain d1jqjb2: 1jqj B:123-244

Lineage for d1jqjb2 (1jqj B:123-244)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.1: DNA polymerase III, beta subunit [55980] (1 protein)
   duplication: consists of three domains of this fold

6. Protein DNA polymerase III, beta subunit [55981] (2 species)

7. Species Escherichia coli [TaxId:562] [55982] (30 PDB entries)
   Uniprot P00583

8. Domain d1jqjb2: 1jqj B:123-244 [67095]
   Other proteins in same PDB: d1jqjc1, d1jqjc2, d1jqjd1, d1jqjd2
   protein/DNA complex

Details for d1jqjb2

PDB Entry: 1jqj, 2.9 Å

PDB Description: mechanism of processivity clamp opening by the delta subunit wrench of the clamp loader complex of e. coli dna polymerase iii: structure of the beta-delta complex

PDB Compounds: (B:) DNA Polymerase III, BETA CHAIN

SCOPe Domain Sequences for d1jqjb2:

Sequence; same for both SEQRES and ATOM records:

>d1jqjb2 d.131.1.1 (B:123-244) DNA polymerase III, beta subunit {Escherichia coli [TaxId: 562]}
qseveftlpqatmkrlieatqfsmahqdvryylngmlfetegeelrtvatdghrlavcsm
pigqslpshsvivprkgvielmrmldggdnplrvqigsnnirahvgdfiftsklvdgrfp
dy

Timeline for d1jqjb2:

• d1jqjb2 first appeared in SCOP 1.59
  
• d1jqjb2 appears in SCOPe 2.07