Lineage for d1jqja2 (1jqj A:123-244)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976821Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2976822Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2976823Family d.131.1.1: DNA polymerase III, beta subunit [55980] (1 protein)
    duplication: consists of three domains of this fold
  6. 2976824Protein DNA polymerase III, beta subunit [55981] (2 species)
  7. 2976825Species Escherichia coli [TaxId:562] [55982] (30 PDB entries)
    Uniprot P00583
  8. 2976998Domain d1jqja2: 1jqj A:123-244 [67092]
    Other proteins in same PDB: d1jqjc1, d1jqjc2, d1jqjd1, d1jqjd2
    protein/DNA complex

Details for d1jqja2

PDB Entry: 1jqj (more details), 2.9 Å

PDB Description: mechanism of processivity clamp opening by the delta subunit wrench of the clamp loader complex of e. coli dna polymerase iii: structure of the beta-delta complex
PDB Compounds: (A:) DNA Polymerase III, BETA CHAIN

SCOPe Domain Sequences for d1jqja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jqja2 d.131.1.1 (A:123-244) DNA polymerase III, beta subunit {Escherichia coli [TaxId: 562]}
qseveftlpqatmkrlieatqfsmahqdvryylngmlfetegeelrtvatdghrlavcsm
pigqslpshsvivprkgvielmrmldggdnplrvqigsnnirahvgdfiftsklvdgrfp
dy

SCOPe Domain Coordinates for d1jqja2:

Click to download the PDB-style file with coordinates for d1jqja2.
(The format of our PDB-style files is described here.)

Timeline for d1jqja2: