Lineage for d1jqja1 (1jqj A:1-122)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 873125Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 873126Superfamily d.131.1: DNA clamp [55979] (2 families) (S)
  5. 873127Family d.131.1.1: DNA polymerase III, beta subunit [55980] (1 protein)
    duplication: consists of three domains of this fold
  6. 873128Protein DNA polymerase III, beta subunit [55981] (2 species)
  7. 873129Species Escherichia coli [TaxId:562] [55982] (10 PDB entries)
    Uniprot P00583
  8. 873181Domain d1jqja1: 1jqj A:1-122 [67091]
    Other proteins in same PDB: d1jqjc1, d1jqjc2, d1jqjd1, d1jqjd2

Details for d1jqja1

PDB Entry: 1jqj (more details), 2.9 Å

PDB Description: mechanism of processivity clamp opening by the delta subunit wrench of the clamp loader complex of e. coli dna polymerase iii: structure of the beta-delta complex
PDB Compounds: (A:) DNA Polymerase III, BETA CHAIN

SCOP Domain Sequences for d1jqja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jqja1 d.131.1.1 (A:1-122) DNA polymerase III, beta subunit {Escherichia coli [TaxId: 562]}
mkftverehllkplqqvsgplggrptlpilgnlllqvadgtlsltgtdlememvarvalv
qphepgattvparkffdicrglpegaeiavqlegermlvrsgrsrfslstlpaadfpnld
dw

SCOP Domain Coordinates for d1jqja1:

Click to download the PDB-style file with coordinates for d1jqja1.
(The format of our PDB-style files is described here.)

Timeline for d1jqja1: