Lineage for d1jqib2 (1jqi B:404-634)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2570412Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 2570413Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 2570414Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (10 protein domains)
  6. 2570431Protein Butyryl-CoA dehydrogenase, NM domains [56647] (2 species)
  7. 2570435Species Norway rat (Rattus norvegicus) [TaxId:10116] [69877] (1 PDB entry)
  8. 2570437Domain d1jqib2: 1jqi B:404-634 [67090]
    Other proteins in same PDB: d1jqia1, d1jqib1
    complexed with caa, fad

Details for d1jqib2

PDB Entry: 1jqi (more details), 2.25 Å

PDB Description: crystal structure of rat short chain acyl-coa dehydrogenase complexed with acetoacetyl-coa
PDB Compounds: (B:) short chain acyl-CoA dehydrogenase

SCOPe Domain Sequences for d1jqib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jqib2 e.6.1.1 (B:404-634) Butyryl-CoA dehydrogenase, NM domains {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vyqsvelpethqmlrqtcrdfaekelvpiaaqldkehlfptsqvkkmgelgllamdvpee
lsgagldylaysialeeisrgcastgvimsvnnslylgpilkfgssqqkqqwitpftngd
kigcfalsepgngsdagaasttareegdswvlngtkawitnsweasatvvfastdrsrqn
kgisaflvpmptpgltlgkkedklgirasstanlifedcripkenllgepg

SCOPe Domain Coordinates for d1jqib2:

Click to download the PDB-style file with coordinates for d1jqib2.
(The format of our PDB-style files is described here.)

Timeline for d1jqib2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jqib1