Lineage for d1jqib1 (1jqi B:635-787)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 97006Fold a.29: Bromodomain-like [47363] (4 superfamilies)
  4. 97021Superfamily a.29.3: Acyl-CoA dehydrogenase (flavoprotein), C-terminal domain [47203] (1 family) (S)
  5. 97022Family a.29.3.1: Acyl-CoA dehydrogenase (flavoprotein), C-terminal domain [47204] (3 protein domains)
  6. 97023Protein Butyryl-CoA dehydrogenase [47205] (2 species)
  7. 97027Species Rat (Rattus norvegicus) [TaxId:10116] [69018] (1 PDB entry)
  8. 97029Domain d1jqib1: 1jqi B:635-787 [67089]
    Other proteins in same PDB: d1jqia2, d1jqib2

Details for d1jqib1

PDB Entry: 1jqi (more details), 2.25 Å

PDB Description: crystal structure of rat short chain acyl-coa dehydrogenase complexed with acetoacetyl-coa

SCOP Domain Sequences for d1jqib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jqib1 a.29.3.1 (B:635-787) Butyryl-CoA dehydrogenase {Rat (Rattus norvegicus)}
mgfkiamqtldmgrigiasqalgiaqasldcavkyaenrhafgapltklqniqfkladma
lalesarlltwraamlkdnkkpftkesamaklaaseaataishqaiqilggmgyvtempa
eryyrdariteiyegtseiqrlviaghllrsyr

SCOP Domain Coordinates for d1jqib1:

Click to download the PDB-style file with coordinates for d1jqib1.
(The format of our PDB-style files is described here.)

Timeline for d1jqib1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jqib2