Lineage for d1jq4a_ (1jq4 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2540890Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2541095Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. 2541183Protein Methane monooxygenase reductase N-terminal domain [69668] (1 species)
  7. 2541184Species Methylococcus capsulatus [TaxId:414] [69669] (1 PDB entry)
  8. 2541185Domain d1jq4a_: 1jq4 A: [67083]
    complexed with fes

Details for d1jq4a_

PDB Entry: 1jq4 (more details)

PDB Description: [2fe-2s] domain of methane monooxygenase reductase from methylococcus capsulatus (bath)
PDB Compounds: (A:) methane monooxygenase component c

SCOPe Domain Sequences for d1jq4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jq4a_ d.15.4.2 (A:) Methane monooxygenase reductase N-terminal domain {Methylococcus capsulatus [TaxId: 414]}
mqrvhtitavtedgeslrfecrsdedvitaalrqniflmsscreggcatckalcsegdyd
lkgcsvqalppeeeeeglvllcrtypktdleielpyth

SCOPe Domain Coordinates for d1jq4a_:

Click to download the PDB-style file with coordinates for d1jq4a_.
(The format of our PDB-style files is described here.)

Timeline for d1jq4a_: