Lineage for d1jq4a_ (1jq4 A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 130887Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 131040Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 131113Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (8 proteins)
  6. 131146Protein Methane monooxygenase reductase N-terminal domain [69668] (1 species)
  7. 131147Species Methylococcus capsulatus [TaxId:414] [69669] (1 PDB entry)
  8. 131148Domain d1jq4a_: 1jq4 A: [67083]

Details for d1jq4a_

PDB Entry: 1jq4 (more details)

PDB Description: [2Fe-2S] Domain of Methane Monooxygenase Reductase from Methylococcus capsulatus (Bath)

SCOP Domain Sequences for d1jq4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jq4a_ d.15.4.2 (A:) Methane monooxygenase reductase N-terminal domain {Methylococcus capsulatus}
mqrvhtitavtedgeslrfecrsdedvitaalrqniflmsscreggcatckalcsegdyd
lkgcsvqalppeeeeeglvllcrtypktdleielpyth

SCOP Domain Coordinates for d1jq4a_:

Click to download the PDB-style file with coordinates for d1jq4a_.
(The format of our PDB-style files is described here.)

Timeline for d1jq4a_: