Lineage for d1jq3d_ (1jq3 D:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (18 families) 
Family c.66.1.17: Spermidine synthase [69557] (1 protein) Protein Spermidine synthase [69558] (1 species) Species Thermotoga maritima [TaxId:243274] [69559] (2 PDB entries) 
Domain d1jq3d_: 1jq3 D: [67082]
Details for d1jq3d_
PDB Entry: 1jq3 (more details), 1.8 Å
PDB Description: Crystal Structure of Spermidine Synthase in Complex with Transition State Analogue AdoDATO
SCOP Domain Sequences for d1jq3d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jq3d_ c.66.1.17 (D:) Spermidine synthase {Thermotoga maritima}
lkelerelqprqhlwyfeyytgnnvglfmkmnrviysgqsdiqridifenpdlgvvfald
gitmttekdefmyhemlahvpmflhpnpkkvliigggdggtlrevlkhdsvekailcevd
glvieaarkylkqtscgfddpraeiviangaeyvrkfknefdviiidstdptagqgghlf
teefyqacydalkedgvfsaetedpfydigwfklayrriskvfpitrvylgfmttypsgm
wsytfaskgidpikdfdpekvrkfnkelkyyneevhvasfalpnfvkkelglm
SCOP Domain Coordinates for d1jq3d_:
Click to download the PDB-style file with coordinates for d1jq3d_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jq3d_:
- d1jq3d_ is new in SCOP 1.59
- d1jq3d_ appears in SCOP 1.61
- d1jq3d_ appears in the current release, SCOPe 2.08
View in 3D
