Lineage for d1jq3c_ (1jq3 C:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 125563Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
  4. 125564Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (18 families) (S)
  5. 125726Family c.66.1.17: Spermidine synthase [69557] (1 protein)
  6. 125727Protein Spermidine synthase [69558] (1 species)
  7. 125728Species Thermotoga maritima [TaxId:243274] [69559] (2 PDB entries)
  8. 125735Domain d1jq3c_: 1jq3 C: [67081]

Details for d1jq3c_

PDB Entry: 1jq3 (more details), 1.8 Å

PDB Description: Crystal Structure of Spermidine Synthase in Complex with Transition State Analogue AdoDATO

SCOP Domain Sequences for d1jq3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jq3c_ c.66.1.17 (C:) Spermidine synthase {Thermotoga maritima}
lkelerelqprqhlwyfeyytgnnvglfmkmnrviysgqsdiqridifenpdlgvvfald
gitmttekdefmyhemlahvpmflhpnpkkvliigggdggtlrevlkhdsvekailcevd
glvieaarkylkqtscgfddpraeiviangaeyvrkfknefdviiidstdptagqgghlf
teefyqacydalkedgvfsaetedpfydigwfklayrriskvfpitrvylgfmttypsgm
wsytfaskgidpikdfdpekvrkfnkelkyyneevhvasfalpnfvkkelglm

SCOP Domain Coordinates for d1jq3c_:

Click to download the PDB-style file with coordinates for d1jq3c_.
(The format of our PDB-style files is described here.)

Timeline for d1jq3c_: