Lineage for d1jq2b_ (1jq2 B:)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1456013Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
    oligomeric transmembrane alpha-helical proteins
  4. 1456014Superfamily f.14.1: Voltage-gated potassium channels [81324] (2 families) (S)
  5. 1456015Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 1456036Protein Potassium channel protein [56901] (2 species)
  7. 1456037Species Streptomyces coelicolor [TaxId:1902] [56902] (20 PDB entries)
    identical sequence to Streptomyces lividans, TaxId: 1916
    Uniprot Q54397 22-124
  8. 1456076Domain d1jq2b_: 1jq2 B: [67076]
    open gate model, residues 86-119; CA-atoms only

Details for d1jq2b_

PDB Entry: 1jq2 (more details)

PDB Description: potassium channel (kcsa) open gate model
PDB Compounds: (B:) Voltage-gated potassium channel

SCOPe Domain Sequences for d1jq2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jq2b_ f.14.1.1 (B:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]}
lwgrcvavvvmvagitsfglvtaalatwfvgreq

SCOPe Domain Coordinates for d1jq2b_:

Click to download the PDB-style file with coordinates for d1jq2b_.
(The format of our PDB-style files is described here.)

Timeline for d1jq2b_: