Lineage for d1jq2a_ (1jq2 A:)

  1. Root: SCOP 1.69
  2. 519077Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)
  3. 519626Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
    oligomeric transmembrane alpha-helical proteins
  4. 519627Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family) (S)
  5. 519628Family f.14.1.1: Voltage-gated potassium channels [81323] (4 proteins)
  6. 519637Protein Potassium channel protein [56901] (1 species)
  7. 519638Species Streptomyces coelicolor and Streptomyces lividans [56902] (13 PDB entries)
  8. 519662Domain d1jq2a_: 1jq2 A: [67075]

Details for d1jq2a_

PDB Entry: 1jq2 (more details)

PDB Description: potassium channel (kcsa) open gate model

SCOP Domain Sequences for d1jq2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jq2a_ f.14.1.1 (A:) Potassium channel protein {Streptomyces coelicolor and Streptomyces lividans}
lwgrcvavvvmvagitsfglvtaalatwfvgreq

SCOP Domain Coordinates for d1jq2a_:

Click to download the PDB-style file with coordinates for d1jq2a_.
(The format of our PDB-style files is described here.)

Timeline for d1jq2a_: