Lineage for d1jq2a_ (1jq2 A:)

  1. Root: SCOP 1.61
  2. 201426Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)
  3. 201495Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 201496Superfamily f.2.1: Membrane all-alpha [56869] (13 families) (S)
  5. 201976Family f.2.1.11: Oligomeric gated channels [63383] (4 proteins)
  6. 201984Protein Potassium channel protein [56901] (1 species)
  7. 201985Species Streptomyces lividans [TaxId:1916] [56902] (8 PDB entries)
  8. 202004Domain d1jq2a_: 1jq2 A: [67075]

Details for d1jq2a_

PDB Entry: 1jq2 (more details)

PDB Description: potassium channel (kcsa) open gate model

SCOP Domain Sequences for d1jq2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jq2a_ f.2.1.11 (A:) Potassium channel protein {Streptomyces lividans}
lwgrcvavvvmvagitsfglvtaalatwfvgreq

SCOP Domain Coordinates for d1jq2a_:

Click to download the PDB-style file with coordinates for d1jq2a_.
(The format of our PDB-style files is described here.)

Timeline for d1jq2a_: