Lineage for d1jpza_ (1jpz A:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 100199Fold a.104: Cytochrome P450 [48263] (1 superfamily)
  4. 100200Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 100201Family a.104.1.1: Cytochrome P450 [48265] (8 proteins)
  6. 100218Protein Cytochrome P450 bm-3 [48268] (1 species)
  7. 100219Species Bacillus megaterium [TaxId:1404] [48269] (8 PDB entries)
  8. 100220Domain d1jpza_: 1jpz A: [67069]

Details for d1jpza_

PDB Entry: 1jpz (more details), 1.65 Å

PDB Description: Crystal structure of a complex of the heme domain of P450BM-3 with N-Palmitoylglycine

SCOP Domain Sequences for d1jpza_:

Sequence, based on SEQRES records: (download)

>d1jpza_ a.104.1.1 (A:) Cytochrome P450 bm-3 {Bacillus megaterium}
tikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlike
acdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammv
diavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvra
ldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlng
kdpetgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvd
pvpsykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipql
hrdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkh
fdfedhtnyeldiketltlkpegfvvkakskkiplggi

Sequence, based on observed residues (ATOM records): (download)

>d1jpza_ a.104.1.1 (A:) Cytochrome P450 bm-3 {Bacillus megaterium}
tikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlike
acdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammv
diavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvra
ldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasqsddllthmlngkd
petgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvdpv
psykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlhr
dktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhfd
fedhtnyeldiketltlkpegfvvkakskkiplggi

SCOP Domain Coordinates for d1jpza_:

Click to download the PDB-style file with coordinates for d1jpza_.
(The format of our PDB-style files is described here.)

Timeline for d1jpza_: