Lineage for d1jpwa_ (1jpw A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006338Family a.118.1.1: Armadillo repeat [48372] (7 protein domains)
  6. 2006339Protein beta-Catenin [48373] (2 species)
  7. 2006340Species Human (Homo sapiens) [TaxId:9606] [48375] (8 PDB entries)
    Uniprot P35222 145-664
  8. 2006351Domain d1jpwa_: 1jpw A: [67059]
    Other proteins in same PDB: d1jpwd_, d1jpwe_, d1jpwf_
    complex with htcf-4

Details for d1jpwa_

PDB Entry: 1jpw (more details), 2.5 Å

PDB Description: Crystal Structure of a Human Tcf-4 / beta-Catenin Complex
PDB Compounds: (A:) beta-catenin

SCOPe Domain Sequences for d1jpwa_:

Sequence, based on SEQRES records: (download)

>d1jpwa_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]}
raipeltkllndedqvvvnkaavmvhqlskkeasrhaimrspqmvsaivrtmqntndvet
arctagtlhnlshhregllaifksggipalvkmlgspvdsvlfyaittlhnlllhqegak
mavrlagglqkmvallnktnvkflaittdclqilaygnqeskliilasggpqalvnimrt
ytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltdpsqrlvqnclwtlrnlsd
aatkqegmegllgtlvqllgsddinvvtcaagilsnltcnnyknkmmvcqvggiealvrt
vlragdreditepaicalrhltsrhqeaemaqnavrlhyglpvvvkllhppshwplikat
vglirnlalcpanhaplreqgaiprlvqllvrahqdtqrrtsmggtqqqfvegvrmeeiv
egctgalhilardvhnrivirglntiplfvqllyspieniqrvaagvlcelaqdkeaaea
ieaegatapltellhsrnegvatyaaavlfrm

Sequence, based on observed residues (ATOM records): (download)

>d1jpwa_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]}
raipeltkllndedqvvvnkaavmvhqlskkeasrhaimrspqmvsaivrtmqntndvet
arctagtlhnlshhregllaifksggipalvkmlgspvdsvlfyaittlhnlllhqegak
mavrlagglqkmvallnktnvkflaittdclqilaygnqeskliilasggpqalvnimrt
ytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltdpsqrlvqnclwtlrnlsd
aatkqegmegllgtlvqllgsddinvvtcaagilsnltcnnyknkmmvcqvggiealvrt
vlragdreditepaicalrhltsrhqeaemaqnavrlhyglpvvvkllhppshwplikat
vglirnlalcpanhaplreqgaiprlvqllvrahqdtqrfvegvrmeeivegctgalhil
ardvhnrivirglntiplfvqllyspieniqrvaagvlcelaqdkeaaeaieaegatapl
tellhsrnegvatyaaavlfrm

SCOPe Domain Coordinates for d1jpwa_:

Click to download the PDB-style file with coordinates for d1jpwa_.
(The format of our PDB-style files is described here.)

Timeline for d1jpwa_: