SCOP 1.59: Domain d1jpvb_: 1jpv B:

Lineage for d1jpvb_ (1jpv B:)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family)

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (3 proteins)

6. Protein 5'-deoxy-5'-methylthioadenosine phosphorylase [53174] (2 species)

7. Species Archaeon Sulfolobus solfataricus [TaxId:2287] [69536] (9 PDB entries)

8. Domain d1jpvb_: 1jpv B: [67057]

Details for d1jpvb_

PDB Entry: 1jpv, 1.8 Å

PDB Description: Crystal Structure of 5'-deoxy-5'-methylthioadenosine phosphorylase complexed with SO4

SCOP Domain Sequences for d1jpvb_:

Sequence; same for both SEQRES and ATOM records:

>d1jpvb_ c.56.2.1 (B:) 5'-deoxy-5'-methylthioadenosine phosphorylase {Archaeon Sulfolobus solfataricus}
pvhilakkgevaervlvvgdpgrarllstllqnpkltnenrgflvytgkyngetvsiath
giggpsiaivleelamlganvfirygttgalvpyinlgeyiivtgasynqgglfyqylrd
nacvastpdfeltnklvtsfskrnlkyyvgnvfssdafyaedeefvkkwssrgniaveme
catlftlskvkgwksatvlvvsdnlakggiwitkeeleksvmdgakavldtlts

Timeline for d1jpvb_:

• d1jpvb_ is new in SCOP 1.59
  
• d1jpvb_ appears in SCOP 1.61
  
• d1jpvb_ appears in the current release, SCOPe 2.08