Lineage for d1jpth2 (1jpt H:118-217)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 785070Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)
  7. 785078Species Human (Homo sapiens) [TaxId:9606] [88575] (172 PDB entries)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3)
    SQ NA # humanized antibody
    Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region
    SQ NA # engineered antibody
    including humanized antibodies (chimeric proteins with human constant domains)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody
  8. 785083Domain d1jpth2: 1jpt H:118-217 [67052]
    Other proteins in same PDB: d1jpth1, d1jptl1, d1jptl2
    part of humanized Fab D3H44 against human tissue factor

Details for d1jpth2

PDB Entry: 1jpt (more details), 1.85 Å

PDB Description: crystal structure of fab d3h44
PDB Compounds: (H:) immunoglobulin Fab D3H44, heavy chain

SCOP Domain Sequences for d1jpth2:

Sequence, based on SEQRES records: (download)

>d1jpth2 b.1.1.2 (H:118-217) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Sequence, based on observed residues (ATOM records): (download)

>d1jpth2 b.1.1.2 (H:118-217) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
ssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

SCOP Domain Coordinates for d1jpth2:

Click to download the PDB-style file with coordinates for d1jpth2.
(The format of our PDB-style files is described here.)

Timeline for d1jpth2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jpth1