Lineage for d1jpth1 (1jpt H:1-117)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1103461Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1103465Species Engineered (including hybrid species) [88562] (67 PDB entries)
    SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # humanized antibody ! SQ NA # Humanized antibody ! SQ NA # engineered antibody
  8. 1103468Domain d1jpth1: 1jpt H:1-117 [67051]
    Other proteins in same PDB: d1jpth2, d1jptl1, d1jptl2
    part of humanized Fab D3H44 against human tissue factor

Details for d1jpth1

PDB Entry: 1jpt (more details), 1.85 Å

PDB Description: crystal structure of fab d3h44
PDB Compounds: (H:) immunoglobulin Fab D3H44, heavy chain

SCOPe Domain Sequences for d1jpth1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jpth1 b.1.1.1 (H:1-117) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
evqlvesggglvqpggslrlscaasgfnikeyymhwvrqapgkglewvglidpeqgntiy
dpkfqdratisadnskntaylqmnslraedtavyycardtaayfdywgqgtlvtvss

SCOPe Domain Coordinates for d1jpth1:

Click to download the PDB-style file with coordinates for d1jpth1.
(The format of our PDB-style files is described here.)

Timeline for d1jpth1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jpth2