Lineage for d1jpth1 (1jpt H:1-117)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219104Species Anti-human tissue humanised factor Fab D3H44 [69136] (2 PDB entries)
  8. 219105Domain d1jpth1: 1jpt H:1-117 [67051]
    Other proteins in same PDB: d1jpth2, d1jptl2

Details for d1jpth1

PDB Entry: 1jpt (more details), 1.85 Å

PDB Description: crystal structure of fab d3h44
PDB Compounds: (H:)

SCOP Domain Sequences for d1jpth1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jpth1 b.1.1.1 (H:1-117) Immunoglobulin (variable domains of L and H chains) {Anti-human tissue humanised factor Fab D3H44}
evqlvesggglvqpggslrlscaasgfnikeyymhwvrqapgkglewvglidpeqgntiy
dpkfqdratisadnskntaylqmnslraedtavyycardtaayfdywgqgtlvtvss

SCOP Domain Coordinates for d1jpth1:

Click to download the PDB-style file with coordinates for d1jpth1.
(The format of our PDB-style files is described here.)

Timeline for d1jpth1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jpth2