SCOPe 2.06: Domain d1jpst2: 1jps T:107-211

Lineage for d1jpst2 (1jps T:107-211)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Extracellular region of human tissue factor [49267] (2 species)
   tandem of fibronectin type III domains

7. Species Human (Homo sapiens) [TaxId:9606] [49268] (34 PDB entries)
   Uniprot P13726 33-242

8. Domain d1jpst2: 1jps T:107-211 [67050]
   Other proteins in same PDB: d1jpsh1, d1jpsh2, d1jpsl1, d1jpsl2

Details for d1jpst2

PDB Entry: 1jps, 1.85 Å

PDB Description: crystal structure of tissue factor in complex with humanized fab d3h44

PDB Compounds: (T:) tissue factor

SCOPe Domain Sequences for d1jpst2:

Sequence; same for both SEQRES and ATOM records:

>d1jpst2 b.1.2.1 (T:107-211) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkk
taktntneflidvdkgenycfsvqavipsrtvnrkstdspvecmg

Timeline for d1jpst2:

• d1jpst2 first appeared in SCOP 1.59
  
• d1jpst2 appears in SCOPe 2.05
  
• d1jpst2 appears in SCOPe 2.07
  
• d1jpst2 appears in the current release, SCOPe 2.08