![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (1 family) ![]() |
![]() | Family b.1.2.1: Fibronectin type III [49266] (18 proteins) |
![]() | Protein Extracellular region of human tissue factor [49267] (2 species) tandem of fibronectin type III domains |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49268] (7 PDB entries) |
![]() | Domain d1jpst2: 1jps T:107-211 [67050] Other proteins in same PDB: d1jpsh1, d1jpsh2, d1jpsl1, d1jpsl2 |
PDB Entry: 1jps (more details), 1.85 Å
SCOP Domain Sequences for d1jpst2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jpst2 b.1.2.1 (T:107-211) Extracellular region of human tissue factor {Human (Homo sapiens)} nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkk taktntneflidvdkgenycfsvqavipsrtvnrkstdspvecmg
Timeline for d1jpst2:
![]() Domains from other chains: (mouse over for more information) d1jpsh1, d1jpsh2, d1jpsl1, d1jpsl2 |