SCOP 1.61: Domain d1jpst2: 1jps T:107-211

Lineage for d1jpst2 (1jps T:107-211)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (16 proteins)

6. Protein Extracellular region of human tissue factor [49267] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49268] (7 PDB entries)

8. Domain d1jpst2: 1jps T:107-211 [67050]
   Other proteins in same PDB: d1jpsh1, d1jpsh2, d1jpsl1, d1jpsl2

Details for d1jpst2

PDB Entry: 1jps, 1.85 Å

PDB Description: crystal structure of tissue factor in complex with humanized fab d3h44

SCOP Domain Sequences for d1jpst2:

Sequence; same for both SEQRES and ATOM records:

>d1jpst2 b.1.2.1 (T:107-211) Extracellular region of human tissue factor {Human (Homo sapiens)}
nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkk
taktntneflidvdkgenycfsvqavipsrtvnrkstdspvecmg

Timeline for d1jpst2:

• d1jpst2 first appeared in SCOP 1.59
  
• d1jpst2 appears in SCOP 1.63
  
• d1jpst2 appears in the current release, SCOPe 2.08