Lineage for d1jpst2 (1jps T:107-211)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 105235Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 105236Family b.1.2.1: Fibronectin type III [49266] (16 proteins)
  6. 105281Protein Extracellular region of human tissue factor [49267] (2 species)
  7. 105282Species Human (Homo sapiens) [TaxId:9606] [49268] (7 PDB entries)
  8. 105286Domain d1jpst2: 1jps T:107-211 [67050]
    Other proteins in same PDB: d1jpsh1, d1jpsh2, d1jpsl1, d1jpsl2

Details for d1jpst2

PDB Entry: 1jps (more details), 1.85 Å

PDB Description: crystal structure of tissue factor in complex with humanized fab d3h44
PDB Compounds: (T:)

SCOP Domain Sequences for d1jpst2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jpst2 b.1.2.1 (T:107-211) Extracellular region of human tissue factor {Human (Homo sapiens)}
nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkk
taktntneflidvdkgenycfsvqavipsrtvnrkstdspvecmg

SCOP Domain Coordinates for d1jpst2:

Click to download the PDB-style file with coordinates for d1jpst2.
(The format of our PDB-style files is described here.)

Timeline for d1jpst2: