Lineage for d1jpst1 (1jps T:5-106)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 290499Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 290500Family b.1.2.1: Fibronectin type III [49266] (20 proteins)
  6. 290548Protein Extracellular region of human tissue factor [49267] (2 species)
    tandem of fibronectin type III domains
  7. 290549Species Human (Homo sapiens) [TaxId:9606] [49268] (7 PDB entries)
  8. 290552Domain d1jpst1: 1jps T:5-106 [67049]
    Other proteins in same PDB: d1jpsh1, d1jpsh2, d1jpsl1, d1jpsl2

Details for d1jpst1

PDB Entry: 1jps (more details), 1.85 Å

PDB Description: crystal structure of tissue factor in complex with humanized fab d3h44

SCOP Domain Sequences for d1jpst1:

Sequence, based on SEQRES records: (download)

>d1jpst1 b.1.2.1 (T:5-106) Extracellular region of human tissue factor {Human (Homo sapiens)}
ntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeiv
kdvkqtylarvfsypagnvestgsageplyenspeftpylet

Sequence, based on observed residues (ATOM records): (download)

>d1jpst1 b.1.2.1 (T:5-106) Extracellular region of human tissue factor {Human (Homo sapiens)}
ntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeiv
kdvkqtylarvfsypagnveplyenspeftpylet

SCOP Domain Coordinates for d1jpst1:

Click to download the PDB-style file with coordinates for d1jpst1.
(The format of our PDB-style files is described here.)

Timeline for d1jpst1: