![]() | Class b: All beta proteins [48724] (110 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (6 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species) |
![]() | Species Anti-human tissue humanised factor Fab D3H44 [69148] (2 PDB entries) |
![]() | Domain d1jpsl2: 1jps L:108-213 [67048] Other proteins in same PDB: d1jpsh1, d1jpsl1, d1jpst1, d1jpst2 |
PDB Entry: 1jps (more details), 1.85 Å
SCOP Domain Sequences for d1jpsl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jpsl2 b.1.1.2 (L:108-213) Immunoglobulin (constant domains of L and H chains) {Anti-human tissue humanised factor Fab D3H44} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge
Timeline for d1jpsl2:
![]() Domains from other chains: (mouse over for more information) d1jpsh1, d1jpsh2, d1jpst1, d1jpst2 |