Lineage for d1jpsl1 (1jps L:1-107)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 451612Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 451613Species Engineered (including hybrid species) [88533] (31 PDB entries)
  8. 451618Domain d1jpsl1: 1jps L:1-107 [67047]
    Other proteins in same PDB: d1jpsh1, d1jpsh2, d1jpsl2, d1jpst1, d1jpst2
    part of humanized Fab D3H44 against human tissue factor

Details for d1jpsl1

PDB Entry: 1jps (more details), 1.85 Å

PDB Description: crystal structure of tissue factor in complex with humanized fab d3h44

SCOP Domain Sequences for d1jpsl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jpsl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
diqmtqspsslsasvgdrvtitcrasrdiksylnwyqqkpgkapkvliyyatslaegvps
rfsgsgsgtdytltisslqpedfatyyclqhgespwtfgqgtkveik

SCOP Domain Coordinates for d1jpsl1:

Click to download the PDB-style file with coordinates for d1jpsl1.
(The format of our PDB-style files is described here.)

Timeline for d1jpsl1: