SCOP 1.63: Domain d1jpsh2: 1jps H:118-217

Lineage for d1jpsh2 (1jps H:118-217)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Anti-human tissue humanised factor Fab D3H44 [69148] (2 PDB entries)

8. Domain d1jpsh2: 1jps H:118-217 [67046]
   Other proteins in same PDB: d1jpsh1, d1jpsl1, d1jpst1, d1jpst2

Details for d1jpsh2

PDB Entry: 1jps, 1.85 Å

PDB Description: crystal structure of tissue factor in complex with humanized fab d3h44

SCOP Domain Sequences for d1jpsh2:

Sequence, based on SEQRES records:

>d1jpsh2 b.1.1.2 (H:118-217) Immunoglobulin (constant domains of L and H chains) {Anti-human tissue humanised factor Fab D3H44}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Sequence, based on observed residues (ATOM records):

>d1jpsh2 b.1.1.2 (H:118-217) Immunoglobulin (constant domains of L and H chains) {Anti-human tissue humanised factor Fab D3H44}
astkgpsvfplapssggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys
lssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Timeline for d1jpsh2:

• d1jpsh2 first appeared in SCOP 1.59
  
• d1jpsh2 appears in SCOP 1.61
  
• d1jpsh2 appears in SCOP 1.65
  
• d1jpsh2 appears in the current release, SCOPe 2.08