Lineage for d1jpsh2 (1jps H:118-217)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 103732Species Anti-human tissue humanised factor Fab D3H44 [69148] (2 PDB entries)
  8. 103735Domain d1jpsh2: 1jps H:118-217 [67046]
    Other proteins in same PDB: d1jpsh1, d1jpsl1, d1jpst1, d1jpst2

Details for d1jpsh2

PDB Entry: 1jps (more details), 1.85 Å

PDB Description: crystal structure of tissue factor in complex with humanized fab d3h44

SCOP Domain Sequences for d1jpsh2:

Sequence, based on SEQRES records: (download)

>d1jpsh2 b.1.1.2 (H:118-217) Immunoglobulin (constant domains of L and H chains) {Anti-human tissue humanised factor Fab D3H44}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Sequence, based on observed residues (ATOM records): (download)

>d1jpsh2 b.1.1.2 (H:118-217) Immunoglobulin (constant domains of L and H chains) {Anti-human tissue humanised factor Fab D3H44}
astkgpsvfplapssggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys
lssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

SCOP Domain Coordinates for d1jpsh2:

Click to download the PDB-style file with coordinates for d1jpsh2.
(The format of our PDB-style files is described here.)

Timeline for d1jpsh2: