SCOPe 2.06: Domain d1jpsh1: 1jps H:1-117

Lineage for d1jpsh1 (1jps H:1-117)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88562] (68 PDB entries)
   SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # humanized antibody ! SQ NA # Humanized antibody ! SQ NA # engineered antibody

8. Domain d1jpsh1: 1jps H:1-117 [67045]
   Other proteins in same PDB: d1jpsh2, d1jpsl1, d1jpsl2, d1jpst1, d1jpst2
   part of humanized Fab D3H44 against human tissue factor

Details for d1jpsh1

PDB Entry: 1jps, 1.85 Å

PDB Description: crystal structure of tissue factor in complex with humanized fab d3h44

PDB Compounds: (H:) immunoglobulin Fab D3H44, heavy chain

SCOPe Domain Sequences for d1jpsh1:

Sequence; same for both SEQRES and ATOM records:

>d1jpsh1 b.1.1.1 (H:1-117) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
evqlvesggglvqpggslrlscaasgfnikeyymhwvrqapgkglewvglidpeqgntiy
dpkfqdratisadnskntaylqmnslraedtavyycardtaayfdywgqgtlvtvss

Timeline for d1jpsh1:

• d1jpsh1 first appeared in SCOP 1.59
  
• d1jpsh1 appears in SCOPe 2.05
  
• d1jpsh1 appears in SCOPe 2.07
  
• d1jpsh1 appears in the current release, SCOPe 2.08