Lineage for d1jpsh1 (1jps H:1-117)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287195Protein Immunoglobulin heavy chain variable domain, VH [88543] (19 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 287196Species Engineered (including hybrid species) [88562] (24 PDB entries)
  8. 287200Domain d1jpsh1: 1jps H:1-117 [67045]
    Other proteins in same PDB: d1jpsh2, d1jpsl1, d1jpsl2, d1jpst1, d1jpst2
    part of humanized Fab D3H44 against human tissue factor

Details for d1jpsh1

PDB Entry: 1jps (more details), 1.85 Å

PDB Description: crystal structure of tissue factor in complex with humanized fab d3h44

SCOP Domain Sequences for d1jpsh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jpsh1 b.1.1.1 (H:1-117) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
evqlvesggglvqpggslrlscaasgfnikeyymhwvrqapgkglewvglidpeqgntiy
dpkfqdratisadnskntaylqmnslraedtavyycardtaayfdywgqgtlvtvss

SCOP Domain Coordinates for d1jpsh1:

Click to download the PDB-style file with coordinates for d1jpsh1.
(The format of our PDB-style files is described here.)

Timeline for d1jpsh1: