SCOP 1.59: Domain d1jpsh1: 1jps H:1-117

Lineage for d1jpsh1 (1jps H:1-117)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species Anti-human tissue humanised factor Fab D3H44 [69136] (2 PDB entries)

8. Domain d1jpsh1: 1jps H:1-117 [67045]
   Other proteins in same PDB: d1jpsh2, d1jpsl2, d1jpst1, d1jpst2

Details for d1jpsh1

PDB Entry: 1jps, 1.85 Å

PDB Description: crystal structure of tissue factor in complex with humanized fab d3h44

SCOP Domain Sequences for d1jpsh1:

Sequence; same for both SEQRES and ATOM records:

>d1jpsh1 b.1.1.1 (H:1-117) Immunoglobulin (variable domains of L and H chains) {Anti-human tissue humanised factor Fab D3H44}
evqlvesggglvqpggslrlscaasgfnikeyymhwvrqapgkglewvglidpeqgntiy
dpkfqdratisadnskntaylqmnslraedtavyycardtaayfdywgqgtlvtvss

Timeline for d1jpsh1:

• d1jpsh1 is new in SCOP 1.59
  
• d1jpsh1 appears in SCOP 1.61
  
• d1jpsh1 appears in the current release, SCOPe 2.08