![]() | Class b: All beta proteins [48724] (110 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (6 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species) |
![]() | Species Anti-human tissue humanised factor Fab D3H44 [69136] (2 PDB entries) |
![]() | Domain d1jpsh1: 1jps H:1-117 [67045] Other proteins in same PDB: d1jpsh2, d1jpsl2, d1jpst1, d1jpst2 |
PDB Entry: 1jps (more details), 1.85 Å
SCOP Domain Sequences for d1jpsh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jpsh1 b.1.1.1 (H:1-117) Immunoglobulin (variable domains of L and H chains) {Anti-human tissue humanised factor Fab D3H44} evqlvesggglvqpggslrlscaasgfnikeyymhwvrqapgkglewvglidpeqgntiy dpkfqdratisadnskntaylqmnslraedtavyycardtaayfdywgqgtlvtvss
Timeline for d1jpsh1:
![]() Domains from other chains: (mouse over for more information) d1jpsl1, d1jpsl2, d1jpst1, d1jpst2 |