SCOP 1.71: Domain d1jpnb1: 1jpn B:1-88

Lineage for d1jpnb1 (1jpn B:1-88)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (24 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (1 family)

5. Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins)

6. Protein Signal sequence recognition protein Ffh [47366] (3 species)

7. Species Thermus aquaticus [TaxId:271] [47367] (11 PDB entries)

8. Domain d1jpnb1: 1jpn B:1-88 [67041]
   Other proteins in same PDB: d1jpna2, d1jpnb2
   complexed with acy, gnp, oc3, oc4

Details for d1jpnb1

PDB Entry: 1jpn, 1.9 Å

PDB Description: GMPPNP Complex of SRP GTPase NG Domain

SCOP Domain Sequences for d1jpnb1:

Sequence; same for both SEQRES and ATOM records:

>d1jpnb1 a.24.13.1 (B:1-88) Signal sequence recognition protein Ffh {Thermus aquaticus}
mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreeal
gkqvlesltpaevilatvyealkealgg

Timeline for d1jpnb1:

• d1jpnb1 first appeared in SCOP 1.59
  
• d1jpnb1 appears in SCOP 1.69
  
• d1jpnb1 appears in SCOP 1.73
  
• d1jpnb1 appears in the current release, SCOPe 2.08