Lineage for d1jpnb1 (1jpn B:1-88)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 96219Fold a.24: Four-helical up-and-down bundle [47161] (14 superfamilies)
  4. 96441Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (1 family) (S)
  5. 96442Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (2 proteins)
  6. 96446Protein Signal sequence recognition protein Ffh [47366] (2 species)
  7. 96450Species Thermus aquaticus [TaxId:271] [47367] (7 PDB entries)
  8. 96452Domain d1jpnb1: 1jpn B:1-88 [67041]
    Other proteins in same PDB: d1jpna2, d1jpnb2

Details for d1jpnb1

PDB Entry: 1jpn (more details), 1.9 Å

PDB Description: GMPPNP Complex of SRP GTPase NG Domain

SCOP Domain Sequences for d1jpnb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jpnb1 a.24.13.1 (B:1-88) Signal sequence recognition protein Ffh {Thermus aquaticus}
mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreeal
gkqvlesltpaevilatvyealkealgg

SCOP Domain Coordinates for d1jpnb1:

Click to download the PDB-style file with coordinates for d1jpnb1.
(The format of our PDB-style files is described here.)

Timeline for d1jpnb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jpnb2