Lineage for d1jpna2 (1jpn A:89-296)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121667Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 121668Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) (S)
  5. 122260Family c.37.1.10: Nitrogenase iron protein-like [52652] (8 proteins)
  6. 122344Protein GTPase domain of the signal sequence recognition protein Ffh [52664] (2 species)
  7. 122348Species Thermus aquaticus [TaxId:271] [52665] (7 PDB entries)
  8. 122349Domain d1jpna2: 1jpn A:89-296 [67040]
    Other proteins in same PDB: d1jpna1, d1jpnb1

Details for d1jpna2

PDB Entry: 1jpn (more details), 1.9 Å

PDB Description: GMPPNP Complex of SRP GTPase NG Domain

SCOP Domain Sequences for d1jpna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jpna2 c.37.1.10 (A:89-296) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus}
earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll
gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev
lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy
fagvsekpeglepfyperlagrilgmgd

SCOP Domain Coordinates for d1jpna2:

Click to download the PDB-style file with coordinates for d1jpna2.
(The format of our PDB-style files is described here.)

Timeline for d1jpna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jpna1