| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (1 family) ![]() |
| Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins) |
| Protein Signal sequence recognition protein Ffh [47366] (3 species) |
| Species Thermus aquaticus [TaxId:271] [47367] (18 PDB entries) |
| Domain d1jpna1: 1jpn A:1-88 [67039] Other proteins in same PDB: d1jpna2, d1jpnb2 |
PDB Entry: 1jpn (more details), 1.9 Å
SCOP Domain Sequences for d1jpna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jpna1 a.24.13.1 (A:1-88) Signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreeal
gkqvlesltpaevilatvyealkealgg
Timeline for d1jpna1: