SCOPe 2.08: Domain d1jpmc2: 1jpm C:1-125

Lineage for d1jpmc2 (1jpm C:1-125)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein L-Ala-D/L-Glu epimerase [69711] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [69713] (2 PDB entries)
   Uniprot O34508

8. Domain d1jpmc2: 1jpm C:1-125 [67036]
   Other proteins in same PDB: d1jpma1, d1jpmb1, d1jpmc1, d1jpmd1
   complexed with gol, mg

Details for d1jpmc2

PDB Entry: 1jpm, 2.25 Å

PDB Description: L-Ala-D/L-Glu Epimerase

PDB Compounds: (C:) L-Ala-D/L-Glu Epimerase

SCOPe Domain Sequences for d1jpmc2:

Sequence; same for both SEQRES and ATOM records:

>d1jpmc2 d.54.1.1 (C:1-125) L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 1423]}
mkiirietsriavpltkpfktalrtvytaesvivritydsgavgwgeapptlvitgdsmd
siesaihhvlkpallgkslagyeailhdiqhlltgnmsakaavemalydgwaqmcglply
qmlgg

Timeline for d1jpmc2:

• d1jpmc2 first appeared in SCOP 1.59
  
• d1jpmc2 appears in SCOPe 2.07