SCOPe 2.06: Domain d1jpmc1: 1jpm C:126-358

Lineage for d1jpmc1 (1jpm C:126-358)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins)

6. Protein L-Ala-D/L-Glu epimerase [69397] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [69399] (2 PDB entries)
   Uniprot O34508

8. Domain d1jpmc1: 1jpm C:126-358 [67035]
   Other proteins in same PDB: d1jpma2, d1jpmb2, d1jpmc2, d1jpmd2
   complexed with gol, mg

Details for d1jpmc1

PDB Entry: 1jpm, 2.25 Å

PDB Description: L-Ala-D/L-Glu Epimerase

PDB Compounds: (C:) L-Ala-D/L-Glu Epimerase

SCOPe Domain Sequences for d1jpmc1:

Sequence; same for both SEQRES and ATOM records:

>d1jpmc1 c.1.11.2 (C:126-358) L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 1423]}
yrdtletdytvsvnspeemaadaenylkqgfqtlkikvgkddiatdiariqeirkrvgsa
vklrldanqgwrpkeavtairkmedaglgielveqpvhkddlaglkkvtdatdtpimade
svftprqafevlqtrsadliniklmkaggisgaekinamaeacgvecmvgsmietklgit
aaahfaaskrnitrfdfdaplmlktdvfnggitysgstismpgkpglgiigaa

Timeline for d1jpmc1:

• d1jpmc1 first appeared in SCOP 1.59
  
• d1jpmc1 appears in SCOPe 2.05
  
• d1jpmc1 appears in SCOPe 2.07
  
• d1jpmc1 appears in the current release, SCOPe 2.08