Lineage for d1jpmc1 (1jpm C:126-358)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 572967Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 573010Family c.1.11.2: D-glucarate dehydratase-like [51609] (11 proteins)
  6. 573062Protein L-Ala-D/L-Glu epimerase [69397] (2 species)
  7. 573063Species Bacillus subtilis [TaxId:1423] [69399] (2 PDB entries)
  8. 573066Domain d1jpmc1: 1jpm C:126-358 [67035]
    Other proteins in same PDB: d1jpma2, d1jpmb2, d1jpmc2, d1jpmd2

Details for d1jpmc1

PDB Entry: 1jpm (more details), 2.25 Å

PDB Description: L-Ala-D/L-Glu Epimerase

SCOP Domain Sequences for d1jpmc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jpmc1 c.1.11.2 (C:126-358) L-Ala-D/L-Glu epimerase {Bacillus subtilis}
yrdtletdytvsvnspeemaadaenylkqgfqtlkikvgkddiatdiariqeirkrvgsa
vklrldanqgwrpkeavtairkmedaglgielveqpvhkddlaglkkvtdatdtpimade
svftprqafevlqtrsadliniklmkaggisgaekinamaeacgvecmvgsmietklgit
aaahfaaskrnitrfdfdaplmlktdvfnggitysgstismpgkpglgiigaa

SCOP Domain Coordinates for d1jpmc1:

Click to download the PDB-style file with coordinates for d1jpmc1.
(The format of our PDB-style files is described here.)

Timeline for d1jpmc1: