Lineage for d1jpma2 (1jpm A:1-125)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503550Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 503551Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 503552Family d.54.1.1: Enolase N-terminal domain-like [54827] (10 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 503641Protein L-Ala-D/L-Glu epimerase [69711] (2 species)
  7. 503642Species Bacillus subtilis [TaxId:1423] [69713] (2 PDB entries)
  8. 503643Domain d1jpma2: 1jpm A:1-125 [67032]
    Other proteins in same PDB: d1jpma1, d1jpmb1, d1jpmc1, d1jpmd1

Details for d1jpma2

PDB Entry: 1jpm (more details), 2.25 Å

PDB Description: L-Ala-D/L-Glu Epimerase

SCOP Domain Sequences for d1jpma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jpma2 d.54.1.1 (A:1-125) L-Ala-D/L-Glu epimerase {Bacillus subtilis}
mkiirietsriavpltkpfktalrtvytaesvivritydsgavgwgeapptlvitgdsmd
siesaihhvlkpallgkslagyeailhdiqhlltgnmsakaavemalydgwaqmcglply
qmlgg

SCOP Domain Coordinates for d1jpma2:

Click to download the PDB-style file with coordinates for d1jpma2.
(The format of our PDB-style files is described here.)

Timeline for d1jpma2: