Lineage for d1jplb1 (1jpl B:1-156)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007623Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) (S)
  5. 2007632Family a.118.9.2: VHS domain [48468] (6 protein domains)
  6. 2007650Protein ADP-ribosylation factor binding protein Gga3 [69097] (1 species)
  7. 2007651Species Human (Homo sapiens) [TaxId:9606] [69098] (3 PDB entries)
  8. 2007661Domain d1jplb1: 1jpl B:1-156 [67028]
    Other proteins in same PDB: d1jpla2, d1jplb2, d1jplc2, d1jpld2
    complexed with peptide from cation-independent mannose 6-phosphate receptor

Details for d1jplb1

PDB Entry: 1jpl (more details), 2.4 Å

PDB Description: GGA3 VHS domain complexed with C-terminal peptide from cation-independent mannose 6-phosphate receptor
PDB Compounds: (B:) ADP-ribosylation factor binding protein gga3

SCOPe Domain Sequences for d1jplb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jplb1 a.118.9.2 (B:1-156) ADP-ribosylation factor binding protein Gga3 {Human (Homo sapiens) [TaxId: 9606]}
maeaegesleswlnkatnpsnrqedweyiigfcdqinkelegpqiavrllahkiqspqew
ealqaltvleacmkncgrrfhnevgkfrflnelikvvspkylgdrvsekvktkviellys
wtmalpeeakikdayhmlkrqgivqsdppipvdrtl

SCOPe Domain Coordinates for d1jplb1:

Click to download the PDB-style file with coordinates for d1jplb1.
(The format of our PDB-style files is described here.)

Timeline for d1jplb1: