Lineage for d1jpla_ (1jpl A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1745105Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1746326Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) (S)
  5. 1746335Family a.118.9.2: VHS domain [48468] (6 proteins)
  6. 1746353Protein ADP-ribosylation factor binding protein Gga3 [69097] (1 species)
  7. 1746354Species Human (Homo sapiens) [TaxId:9606] [69098] (3 PDB entries)
  8. 1746363Domain d1jpla_: 1jpl A: [67027]
    complexed with peptide from cation-independent mannose 6-phosphate receptor

Details for d1jpla_

PDB Entry: 1jpl (more details), 2.4 Å

PDB Description: GGA3 VHS domain complexed with C-terminal peptide from cation-independent mannose 6-phosphate receptor
PDB Compounds: (A:) ADP-ribosylation factor binding protein gga3

SCOPe Domain Sequences for d1jpla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jpla_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga3 {Human (Homo sapiens) [TaxId: 9606]}
amgsmaeaegesleswlnkatnpsnrqedweyiigfcdqinkelegpqiavrllahkiqs
pqewealqaltvleacmkncgrrfhnevgkfrflnelikvvspkylgdrvsekvktkvie
llyswtmalpeeakikdayhmlkrqgivqsdppipvdrtli

SCOPe Domain Coordinates for d1jpla_:

Click to download the PDB-style file with coordinates for d1jpla_.
(The format of our PDB-style files is described here.)

Timeline for d1jpla_: