Lineage for d1jpla_ (1jpl A:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 100538Fold a.118: alpha-alpha superhelix [48370] (13 superfamilies)
  4. 100792Superfamily a.118.9: ENTH/VHS domain [48464] (2 families) (S)
  5. 100800Family a.118.9.2: VHS domain [48468] (3 proteins)
  6. 100801Protein Gga3 [69097] (1 species)
  7. 100802Species Human (Homo sapiens) [TaxId:9606] [69098] (2 PDB entries)
  8. 100807Domain d1jpla_: 1jpl A: [67027]

Details for d1jpla_

PDB Entry: 1jpl (more details), 2.4 Å

PDB Description: GGA3 VHS domain complexed with C-terminal peptide from cation-independent mannose 6-phosphate receptor
PDB Compounds: (A:)

SCOP Domain Sequences for d1jpla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jpla_ a.118.9.2 (A:) Gga3 {Human (Homo sapiens)}
amgsmaeaegesleswlnkatnpsnrqedweyiigfcdqinkelegpqiavrllahkiqs
pqewealqaltvleacmkncgrrfhnevgkfrflnelikvvspkylgdrvsekvktkvie
llyswtmalpeeakikdayhmlkrqgivqsdppipvdrtli

SCOP Domain Coordinates for d1jpla_:

Click to download the PDB-style file with coordinates for d1jpla_.
(The format of our PDB-style files is described here.)

Timeline for d1jpla_: