Lineage for d1jpja2 (1jpj A:89-294)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242911Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 242912Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families) (S)
    division into families based on beta-sheet topologies
  5. 243628Family c.37.1.10: Nitrogenase iron protein-like [52652] (8 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 243724Protein GTPase domain of the signal sequence recognition protein Ffh [52664] (2 species)
  7. 243728Species Thermus aquaticus [TaxId:271] [52665] (8 PDB entries)
  8. 243737Domain d1jpja2: 1jpj A:89-294 [67025]
    Other proteins in same PDB: d1jpja1
    complexed with gnp

Details for d1jpja2

PDB Entry: 1jpj (more details), 2.3 Å

PDB Description: GMPPNP Complex of SRP GTPase NG Domain

SCOP Domain Sequences for d1jpja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jpja2 c.37.1.10 (A:89-294) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus}
earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll
gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev
lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy
fagvsekpeglepfyperlagrilgm

SCOP Domain Coordinates for d1jpja2:

Click to download the PDB-style file with coordinates for d1jpja2.
(The format of our PDB-style files is described here.)

Timeline for d1jpja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jpja1