Lineage for d1jpja1 (1jpj A:1-88)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 211870Fold a.24: Four-helical up-and-down bundle [47161] (16 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 212106Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (1 family) (S)
  5. 212107Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (2 proteins)
  6. 212111Protein Signal sequence recognition protein Ffh [47366] (2 species)
  7. 212115Species Thermus aquaticus [TaxId:271] [47367] (8 PDB entries)
  8. 212124Domain d1jpja1: 1jpj A:1-88 [67024]
    Other proteins in same PDB: d1jpja2
    complexed with gnp

Details for d1jpja1

PDB Entry: 1jpj (more details), 2.3 Å

PDB Description: GMPPNP Complex of SRP GTPase NG Domain

SCOP Domain Sequences for d1jpja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jpja1 a.24.13.1 (A:1-88) Signal sequence recognition protein Ffh {Thermus aquaticus}
mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreeal
gkqvlesltpaevilatvyealkealgg

SCOP Domain Coordinates for d1jpja1:

Click to download the PDB-style file with coordinates for d1jpja1.
(The format of our PDB-style files is described here.)

Timeline for d1jpja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jpja2