Lineage for d1jpgb_ (1jpg B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2356942Protein beta2-microglobulin [88600] (7 species)
  7. 2357723Species Mouse (Mus musculus) [TaxId:10090] [88603] (222 PDB entries)
    Uniprot P01887
  8. 2357811Domain d1jpgb_: 1jpg B: [67021]
    Other proteins in same PDB: d1jpga1, d1jpga2

Details for d1jpgb_

PDB Entry: 1jpg (more details), 2.2 Å

PDB Description: crystal structure of the lcmv peptidic epitope np396 in complex with the murine class i mhc molecule h-2db
PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d1jpgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jpgb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d1jpgb_:

Click to download the PDB-style file with coordinates for d1jpgb_.
(The format of our PDB-style files is described here.)

Timeline for d1jpgb_: