SCOPe 2.02: Domain d1jpgb_: 1jpg B:

Lineage for d1jpgb_ (1jpg B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (150 PDB entries)
   Uniprot P01887

8. Domain d1jpgb_: 1jpg B: [67021]
   Other proteins in same PDB: d1jpga1, d1jpga2

Details for d1jpgb_

PDB Entry: 1jpg, 2.2 Å

PDB Description: crystal structure of the lcmv peptidic epitope np396 in complex with the murine class i mhc molecule h-2db

PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d1jpgb_:

Sequence; same for both SEQRES and ATOM records:

>d1jpgb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1jpgb_:

• d1jpgb_ first appeared in SCOP 1.59, called d1jpgb1
  
• d1jpgb_ appears in SCOPe 2.01
  
• d1jpgb_ appears in SCOPe 2.03
  
• d1jpgb_ appears in the current release, SCOPe 2.08